2.97 Rating by CuteStat

10thplanetspringvalleykidscamp.com is 5 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, 10thplanetspringvalleykidscamp.com is SAFE to browse.

PageSpeed Score
78
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.22.184

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 14
H3 Headings: 7 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: UA-58695071-1

Websites Hosted on Same IP (i.e. 104.28.22.184)

Športový tovar a fitness potreby

- obchodobchodov.sk
Not Applicable $ 8.95

IMAX Worldwide Home

- imaxcorp.com

IMAX Corp Worldwide Home

768,940 $ 1,680.00

ASTV.RU Сахалинская область. Новости, бизнес, общение, объявления, пог

- astv.ru

Сахалинская область, Сахалин. Новости, бизнес, общение, объявления, погода.

143,452 $ 83,400.00

3 Common Reasons Toddlers Refuse To Wear a Coat:

- yucaa.com
Not Applicable $ 8.95

au-star.asia | 524: A timeout occurred

- au-star.asia
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 23 May 2018 19:18:30 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Via: 1.1 vegur
Server: cloudflare
CF-RAY: 41f9de64e4cb2186-EWR
Content-Encoding: gzip

Domain Information

Domain Registrar: NameSilo, LLC
Registration Date: May 22, 2018, 12:00 AM 5 years 11 months 1 week ago
Last Modified: May 22, 2018, 12:00 AM 5 years 11 months 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
glen.ns.cloudflare.com 108.162.193.169 United States of America United States of America
dara.ns.cloudflare.com 172.64.32.91 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
10thplanetspringvalleykidscamp.com A 300 IP: 104.28.22.184
10thplanetspringvalleykidscamp.com A 300 IP: 104.28.23.184
10thplanetspringvalleykidscamp.com NS 86400 Target: dara.ns.cloudflare.com
10thplanetspringvalleykidscamp.com NS 86400 Target: glen.ns.cloudflare.com
10thplanetspringvalleykidscamp.com SOA 3600 MNAME: dara.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2027869483
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
10thplanetspringvalleykidscamp.com AAAA 300 IPV6: 2400:cb00:2048:1::681c:17b8
10thplanetspringvalleykidscamp.com AAAA 300 IPV6: 2400:cb00:2048:1::681c:16b8

Full WHOIS Lookup

Domain Name: 10THPLANETSPRINGVALLEYKIDSCAMP.COM
Registry Domain ID: 2266268243_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: http://www.namesilo.com
Updated Date: 2018-05-22T22:20:06Z
Creation Date: 2018-05-22T16:28:56Z
Registry Expiry Date: 2019-05-22T16:28:56Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: abuse@namesilo.com
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DARA.NS.CLOUDFLARE.COM
Name Server: GLEN.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-23T19:18:36Z